View larger

C20orf18 monoclonal antibody (M01), clone 3C3

Reference:

Condition: New product

Data sheet of C20orf18 monoclonal antibody (M01), clone 3C3

Brand:	Abnova
Reference:	H00010616-M01
Product name:	C20orf18 monoclonal antibody (M01), clone 3C3
Product description:	Mouse monoclonal antibody raised against a partial recombinant C20orf18.
Clone:	3C3
Isotype:	IgG2b Kappa
Gene id:	10616
Gene name:	RBCK1
Gene alias:	C20orf18\|HOIL1\|RBCK2\|RNF54\|UBCE7IP3\|XAP3\|XAP4\|ZRANB4
Gene description:	RanBP-type and C3HC4-type zinc finger containing 1
Genbank accession:	NM_006462
Immunogen:	C20orf18 (NP_006453, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ
Protein accession:	NP_006453
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.41 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged C20orf18 is approximately 0.03ng/ml as a capture antibody.
Applications:	IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition:	Dry Ice