Brand: | Abnova |
Reference: | H00010616-D01P |
Product name: | RBCK1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RBCK1 protein. |
Gene id: | 10616 |
Gene name: | RBCK1 |
Gene alias: | C20orf18|HOIL1|RBCK2|RNF54|UBCE7IP3|XAP3|XAP4|ZRANB4 |
Gene description: | RanBP-type and C3HC4-type zinc finger containing 1 |
Genbank accession: | ENST00000290048 |
Immunogen: | RBCK1 (ENSP00000290048, 1 a.a. ~ 230 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH |
Protein accession: | ENSP00000290048 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RBCK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of RBCK1 expression in human stomach. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |