Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RBCK1 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,IP |
More info about RBCK1 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00010616-D01 |
| Product name: | RBCK1 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human RBCK1 protein. |
| Gene id: | 10616 |
| Gene name: | RBCK1 |
| Gene alias: | C20orf18|HOIL1|RBCK2|RNF54|UBCE7IP3|XAP3|XAP4|ZRANB4 |
| Gene description: | RanBP-type and C3HC4-type zinc finger containing 1 |
| Genbank accession: | ENST00000290048 |
| Immunogen: | RBCK1 (ENSP00000290048, 1 a.a. ~ 230 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH |
| Protein accession: | ENSP00000290048 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RBCK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of RBCK1 expression in human stomach. |
| Applications: | WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |