Cart 213 Product Products 65 818,91 € (empty)
-
-
-
1 x USP45...259,07 € -
-
-
-
1 x Granzyme H...259,07 € -
-
-
-
-
-
-
-
1 x Phospho-Lc...259,07 € -
-
1 x Ubr1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MRP3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD22...259,07 € -
-
-
-
-
-
-
1 x LAT...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-Ga...259,07 € -
-
1 x Na+/K+-ATP...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CARKL...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x NPAS2...259,07 € -
-
-
-
-
-
-
1 x ApoL2...259,07 € -
-
-
-
-
1 x Phospho-Ku...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CYP2A6/7/1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x UDG...259,07 €
No products
To be determined Shipping
65 818,91 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 213 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 65 818,91 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 65 818,91 €
Data sheet of ST6GALNAC2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about ST6GALNAC2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010610-B01P |
| Product name: | ST6GALNAC2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ST6GALNAC2 protein. |
| Gene id: | 10610 |
| Gene name: | ST6GALNAC2 |
| Gene alias: | FLJ45660|SAITL1|SIAT7|SIAT7B|SIATL1|ST6GalNAII|STHM |
| Gene description: | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 |
| Genbank accession: | BC040455.1 |
| Immunogen: | ST6GALNAC2 (AAH40455.1, 1 a.a. ~ 374 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR |
| Protein accession: | AAH40455.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ST6GALNAC2 expression in transfected 293T cell line (H00010610-T01) by ST6GALNAC2 MaxPab polyclonal antibody. Lane 1: ST6GALNAC2 transfected lysate(41.14 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |