| Brand: | Abnova |
| Reference: | H00010610-A01 |
| Product name: | ST6GALNAC2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ST6GALNAC2. |
| Gene id: | 10610 |
| Gene name: | ST6GALNAC2 |
| Gene alias: | FLJ45660|SAITL1|SIAT7|SIAT7B|SIATL1|ST6GalNAII|STHM |
| Gene description: | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 |
| Genbank accession: | NM_006456 |
| Immunogen: | ST6GALNAC2 (NP_006447, 161 a.a. ~ 270 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASAS |
| Protein accession: | NP_006447 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ST6GALNAC2 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of ST6GALNAC2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |