No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010610-A01 |
Product name: | ST6GALNAC2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ST6GALNAC2. |
Gene id: | 10610 |
Gene name: | ST6GALNAC2 |
Gene alias: | FLJ45660|SAITL1|SIAT7|SIAT7B|SIATL1|ST6GalNAII|STHM |
Gene description: | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 |
Genbank accession: | NM_006456 |
Immunogen: | ST6GALNAC2 (NP_006447, 161 a.a. ~ 270 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASAS |
Protein accession: | NP_006447 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ST6GALNAC2 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of ST6GALNAC2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |