| Brand: | Abnova |
| Reference: | H00010606-M01 |
| Product name: | PAICS monoclonal antibody (M01), clone 4F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PAICS. |
| Clone: | 4F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10606 |
| Gene name: | PAICS |
| Gene alias: | ADE2|ADE2H1|AIRC|DKFZp781N1372|MGC1343|MGC5024|PAIS |
| Gene description: | phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase |
| Genbank accession: | BC010273 |
| Immunogen: | PAICS (AAH10273, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL |
| Protein accession: | AAH10273 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PAICS monoclonal antibody (M01), clone 4F4. Western Blot analysis of PAICS expression in human placenta. |
| Applications: | WB-Ti,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |