No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00010606-M01 |
Product name: | PAICS monoclonal antibody (M01), clone 4F4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PAICS. |
Clone: | 4F4 |
Isotype: | IgG2a Kappa |
Gene id: | 10606 |
Gene name: | PAICS |
Gene alias: | ADE2|ADE2H1|AIRC|DKFZp781N1372|MGC1343|MGC5024|PAIS |
Gene description: | phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase |
Genbank accession: | BC010273 |
Immunogen: | PAICS (AAH10273, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL |
Protein accession: | AAH10273 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PAICS monoclonal antibody (M01), clone 4F4. Western Blot analysis of PAICS expression in human placenta. |
Applications: | WB-Ti,S-ELISA,ELISA |
Shipping condition: | Dry Ice |