No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00010602-D01P |
Product name: | CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CDC42EP3 protein. |
Gene id: | 10602 |
Gene name: | CDC42EP3 |
Gene alias: | BORG2|CEP3|FLJ46903|UB1 |
Gene description: | CDC42 effector protein (Rho GTPase binding) 3 |
Genbank accession: | NM_006449.3 |
Immunogen: | CDC42EP3 (NP_006440.2, 1 a.a. ~ 254 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK |
Protein accession: | NP_006440.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CDC42EP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC42EP3 expression in A-431. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |