Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00010602-D01P |
| Product name: | CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CDC42EP3 protein. |
| Gene id: | 10602 |
| Gene name: | CDC42EP3 |
| Gene alias: | BORG2|CEP3|FLJ46903|UB1 |
| Gene description: | CDC42 effector protein (Rho GTPase binding) 3 |
| Genbank accession: | NM_006449.3 |
| Immunogen: | CDC42EP3 (NP_006440.2, 1 a.a. ~ 254 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK |
| Protein accession: | NP_006440.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDC42EP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC42EP3 expression in A-431. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |