| Brand: | Abnova |
| Reference: | H00010602-A01 |
| Product name: | CDC42EP3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CDC42EP3. |
| Gene id: | 10602 |
| Gene name: | CDC42EP3 |
| Gene alias: | BORG2|CEP3|FLJ46903|UB1 |
| Gene description: | CDC42 effector protein (Rho GTPase binding) 3 |
| Genbank accession: | NM_006449 |
| Immunogen: | CDC42EP3 (NP_006440, 42 a.a. ~ 108 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAIS |
| Protein accession: | NP_006440 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDC42EP3 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of CDC42EP3 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with CDC42 effector proteins.Schnack C, Danzer KM, Hengerer B, Gillardon F. Neuroscience. 2008 Jul 17;154(4):1450-7. Epub 2008 Feb 29. |