Brand: | Abnova |
Reference: | H00010599-A01 |
Product name: | SLCO1B1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SLCO1B1. |
Gene id: | 10599 |
Gene name: | SLCO1B1 |
Gene alias: | LST-1|LST1|MGC133282|OATP-C|OATP1B1|OATP2|OATPC|SLC21A6 |
Gene description: | solute carrier organic anion transporter family, member 1B1 |
Genbank accession: | NM_006446 |
Immunogen: | SLCO1B1 (NP_006437, 481 a.a. ~ 570 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL |
Protein accession: | NP_006437 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |