Cart 91 Product Products 29 469,31 € (empty)
No products
To be determined Shipping
29 469,31 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 91 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 29 469,31 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 29 469,31 €
Data sheet of IFITM2 monoclonal antibody (M14), clone 1F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about IFITM2 monoclonal antibody (M14), clone 1F2
| Brand: | Abnova |
| Reference: | H00010581-M14 |
| Product name: | IFITM2 monoclonal antibody (M14), clone 1F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IFITM2. |
| Clone: | 1F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10581 |
| Gene name: | IFITM2 |
| Gene alias: | 1-8D |
| Gene description: | interferon induced transmembrane protein 2 (1-8D) |
| Genbank accession: | NM_006435 |
| Immunogen: | IFITM2 (NP_006426.1, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW |
| Protein accession: | NP_006426.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IFITM2 monoclonal antibody (M14), clone 1F2. Western Blot analysis of IFITM2 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |