View larger

GNLY monoclonal antibody (M08), clone 2A6

Reference:

Condition: New product

Data sheet of GNLY monoclonal antibody (M08), clone 2A6

Brand:	Abnova
Reference:	H00010578-M08
Product name:	GNLY monoclonal antibody (M08), clone 2A6
Product description:	Mouse monoclonal antibody raised against a partial recombinant GNLY.
Clone:	2A6
Isotype:	IgG2a Kappa
Gene id:	10578
Gene name:	GNLY
Gene alias:	519\|D2S69E\|LAG-2\|LAG2\|NKG5\|TLA519
Gene description:	granulysin
Genbank accession:	NM_006433
Immunogen:	GNLY (NP_006424.2, 46 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	LAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
Protein accession:	NP_006424.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.74 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged GNLY is 0.3 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice