Cart 8 Product Products 2 010,16 € (empty)
No products
To be determined Shipping
2 010,16 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 010,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 010,16 €
Data sheet of GNLY purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about GNLY purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010578-B01P |
| Product name: | GNLY purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GNLY protein. |
| Gene id: | 10578 |
| Gene name: | GNLY |
| Gene alias: | 519|D2S69E|LAG-2|LAG2|NKG5|TLA519 |
| Gene description: | granulysin |
| Genbank accession: | NM_006433.2 |
| Immunogen: | GNLY (NP_006424.2, 1 a.a. ~ 145 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| Protein accession: | NP_006424.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GNLY expression in transfected 293T cell line (H00010578-T01) by GNLY MaxPab polyclonal antibody. Lane 1: GNLY transfected lysate(15.95 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |