Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00010578-B01P |
Product name: | GNLY purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human GNLY protein. |
Gene id: | 10578 |
Gene name: | GNLY |
Gene alias: | 519|D2S69E|LAG-2|LAG2|NKG5|TLA519 |
Gene description: | granulysin |
Genbank accession: | NM_006433.2 |
Immunogen: | GNLY (NP_006424.2, 1 a.a. ~ 145 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
Protein accession: | NP_006424.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GNLY expression in transfected 293T cell line (H00010578-T01) by GNLY MaxPab polyclonal antibody. Lane 1: GNLY transfected lysate(15.95 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |