Brand: | Abnova |
Reference: | H00010577-D01P |
Product name: | NPC2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NPC2 protein. |
Gene id: | 10577 |
Gene name: | NPC2 |
Gene alias: | HE1|MGC1333|NP-C2 |
Gene description: | Niemann-Pick disease, type C2 |
Genbank accession: | NM_006432.3 |
Immunogen: | NPC2 (NP_006423.1, 1 a.a. ~ 151 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
Protein accession: | NP_006423.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in mouse lung. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |