| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010577-B01P |
| Product name: | NPC2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NPC2 protein. |
| Gene id: | 10577 |
| Gene name: | NPC2 |
| Gene alias: | HE1|MGC1333|NP-C2 |
| Gene description: | Niemann-Pick disease, type C2 |
| Genbank accession: | NM_006432.3 |
| Immunogen: | NPC2 (NP_006423.1, 1 a.a. ~ 151 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
| Protein accession: | NP_006423.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NPC2 expression in transfected 293T cell line (H00010577-T01) by NPC2 MaxPab polyclonal antibody. Lane 1: NPC2 transfected lysate(16.61 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Comparative analysis of the seminal plasma proteomes of oligoasthenozoospermic and normozoospermic men.Giacomini E, Ura B, Giolo E, Luppi S, Martinelli M, Garcia RC, Ricci G. Reprod Biomed Online. 2015 May;30(5):522-31. |