| Brand: | Abnova |
| Reference: | H00010574-M02 |
| Product name: | CCT7 monoclonal antibody (M02), clone 3A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCT7. |
| Clone: | 3A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10574 |
| Gene name: | CCT7 |
| Gene alias: | CCT-ETA|Ccth|MGC110985|Nip7-1|TCP-1-eta |
| Gene description: | chaperonin containing TCP1, subunit 7 (eta) |
| Genbank accession: | BC019296 |
| Immunogen: | CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD |
| Protein accession: | AAH19296 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CCT7 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Reconstitution of the human chaperonin CCT by co-expression of the eight distinct subunits in mammalian cells.Machida K, Masutani M, Kobayashi T, Mikami S, Nishino Y, Miyazawa A, Imataka H. Protein Expr Purif. 2011 Nov 22. |