Cart 3 Product Products 734,47 € (empty)
No products
To be determined Shipping
734,47 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 734,47 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 734,47 €
Data sheet of SIVA purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about SIVA purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010572-B01P |
| Product name: | SIVA purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SIVA protein. |
| Gene id: | 10572 |
| Gene name: | SIVA1 |
| Gene alias: | CD27BP|SIVA|Siva-1|Siva-2 |
| Gene description: | SIVA1, apoptosis-inducing factor |
| Genbank accession: | BC034562 |
| Immunogen: | SIVA (AAH34562, 1 a.a. ~ 110 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET |
| Protein accession: | AAH34562 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SIVA1 expression in transfected 293T cell line (H00010572-T03) by SIVA1 MaxPab polyclonal antibody. Lane 1: SIVA transfected lysate(12.21 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |