No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010560-M10 |
| Product name: | SLC19A2 monoclonal antibody (M10), clone 5B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC19A2. |
| Clone: | 5B10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10560 |
| Gene name: | SLC19A2 |
| Gene alias: | TC1|THT1|THTR1|TRMA |
| Gene description: | solute carrier family 19 (thiamine transporter), member 2 |
| Genbank accession: | NM_006996.1 |
| Immunogen: | SLC19A2 (NP_008927.1, 209 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND |
| Protein accession: | NP_008927.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged SLC19A2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |