View larger

SPTLC1 monoclonal antibody (M09), clone 3D11

Reference:

Condition: New product

Data sheet of SPTLC1 monoclonal antibody (M09), clone 3D11

Brand:	Abnova
Reference:	H00010558-M09
Product name:	SPTLC1 monoclonal antibody (M09), clone 3D11
Product description:	Mouse monoclonal antibody raised against a full-length recombinant SPTLC1.
Clone:	3D11
Isotype:	IgG2a Kappa
Gene id:	10558
Gene name:	SPTLC1
Gene alias:	HSAN\|HSAN1\|HSN1\|LBC1\|LCB1\|MGC14645\|SPT1\|SPTI
Gene description:	serine palmitoyltransferase, long chain base subunit 1
Genbank accession:	BC007085
Immunogen:	SPTLC1 (AAH07085, 43 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	TYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAATLASLKKYGVGTCGPRGFYGTFE
Protein accession:	AAH07085
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.85 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged SPTLC1 is 0.3 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice