Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HTATIP2 monoclonal antibody (M01), clone 4G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about HTATIP2 monoclonal antibody (M01), clone 4G8
| Brand: | Abnova |
| Reference: | H00010553-M01 |
| Product name: | HTATIP2 monoclonal antibody (M01), clone 4G8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HTATIP2. |
| Clone: | 4G8 |
| Isotype: | IgG2a lambda |
| Gene id: | 10553 |
| Gene name: | HTATIP2 |
| Gene alias: | CC3|FLJ26963|SDR44U1|TIP30 |
| Gene description: | HIV-1 Tat interactive protein 2, 30kDa |
| Genbank accession: | BC002439 |
| Immunogen: | HTATIP2 (AAH02439, 1 a.a. ~ 242 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP |
| Protein accession: | AAH02439 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |