No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010551-M04A |
| Product name: | AGR2 monoclonal antibody (M04A), clone 7E9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant AGR2. |
| Clone: | 7E9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10551 |
| Gene name: | AGR2 |
| Gene alias: | AG2|GOB-4|HAG-2|XAG-2 |
| Gene description: | anterior gradient homolog 2 (Xenopus laevis) |
| Genbank accession: | BC015503 |
| Immunogen: | AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
| Protein accession: | AAH15503.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |