Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HBXIP monoclonal antibody (M12), clone 4G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HBXIP monoclonal antibody (M12), clone 4G1
| Brand: | Abnova |
| Reference: | H00010542-M12 |
| Product name: | HBXIP monoclonal antibody (M12), clone 4G1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant HBXIP. |
| Clone: | 4G1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10542 |
| Gene name: | HBXIP |
| Gene alias: | MGC71071|XIP |
| Gene description: | hepatitis B virus x interacting protein |
| Genbank accession: | BC062619 |
| Immunogen: | HBXIP (AAH62619, 83 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS |
| Protein accession: | AAH62619 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HBXIP expression in transfected 293T cell line by HBXIP monoclonal antibody (M12), clone 4G1. Lane 1: HBXIP transfected lysate(10.12 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |