| Brand: | Abnova |
| Reference: | H00010542-M02A |
| Product name: | HBXIP monoclonal antibody (M02A), clone 3D3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant HBXIP. |
| Clone: | 3D3 |
| Isotype: | IgM Kappa |
| Gene id: | 10542 |
| Gene name: | HBXIP |
| Gene alias: | MGC71071|XIP |
| Gene description: | hepatitis B virus x interacting protein |
| Genbank accession: | BC062619 |
| Immunogen: | HBXIP (AAH62619, 83 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS |
| Protein accession: | AAH62619 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |