No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010540-M01 |
| Product name: | DCTN2 monoclonal antibody (M01), clone 2G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCTN2. |
| Clone: | 2G7 |
| Isotype: | IgG1 lambda |
| Gene id: | 10540 |
| Gene name: | DCTN2 |
| Gene alias: | DCTN50|DYNAMITIN|RBP50 |
| Gene description: | dynactin 2 (p50) |
| Genbank accession: | BC000718 |
| Immunogen: | DCTN2 (AAH00718, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK |
| Protein accession: | AAH00718 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to DCTN2 on MCF-7 cell . [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |