No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00010538-M01 |
Product name: | BATF monoclonal antibody (M01), clone 8A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BATF. |
Clone: | 8A12 |
Isotype: | IgG1 Kappa |
Gene id: | 10538 |
Gene name: | BATF |
Gene alias: | B-ATF|BATF1|SFA-2|SFA2 |
Gene description: | basic leucine zipper transcription factor, ATF-like |
Genbank accession: | NM_006399 |
Immunogen: | BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
Protein accession: | NP_006390 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | Basic leucine zipper transcription factor, ATF-like (BATF) regulates epigenetically and energetically effector CD8 T-cell differentiation via Sirt1 expression.Kuroda S, Yamazaki M, Abe M, Sakimura K, Takayanagi H, Iwai Y. Proc Natl Acad Sci U S A. 2011 Sep 6;108(36):14885-9. Epub 2011 Aug 22. |