Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BATF monoclonal antibody (M01), clone 8A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about BATF monoclonal antibody (M01), clone 8A12
| Brand: | Abnova |
| Reference: | H00010538-M01 |
| Product name: | BATF monoclonal antibody (M01), clone 8A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BATF. |
| Clone: | 8A12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10538 |
| Gene name: | BATF |
| Gene alias: | B-ATF|BATF1|SFA-2|SFA2 |
| Gene description: | basic leucine zipper transcription factor, ATF-like |
| Genbank accession: | NM_006399 |
| Immunogen: | BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
| Protein accession: | NP_006390 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Basic leucine zipper transcription factor, ATF-like (BATF) regulates epigenetically and energetically effector CD8 T-cell differentiation via Sirt1 expression.Kuroda S, Yamazaki M, Abe M, Sakimura K, Takayanagi H, Iwai Y. Proc Natl Acad Sci U S A. 2011 Sep 6;108(36):14885-9. Epub 2011 Aug 22. |