| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00010538-D01P |
| Product name: | BATF purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human BATF protein. |
| Gene id: | 10538 |
| Gene name: | BATF |
| Gene alias: | B-ATF|BATF1|SFA-2|SFA2 |
| Gene description: | basic leucine zipper transcription factor, ATF-like |
| Genbank accession: | NM_006399.2 |
| Immunogen: | BATF (NP_006390.1, 1 a.a. ~ 125 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
| Protein accession: | NP_006390.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of BATF expression in transfected 293T cell line (H00010538-T02) by BATF MaxPab polyclonal antibody. Lane 1: BATF transfected lysate(14.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |