| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010537-B01P |
| Product name: | UBD purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human UBD protein. |
| Gene id: | 10537 |
| Gene name: | UBD |
| Gene alias: | FAT10|GABBR1|UBD-3 |
| Gene description: | ubiquitin D |
| Genbank accession: | NM_006398 |
| Immunogen: | UBD (NP_006389.1, 1 a.a. ~ 165 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCIGG |
| Protein accession: | NP_006389.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of UBD expression in transfected 293T cell line (H00010537-T02) by UBD MaxPab polyclonal antibody. Lane 1: UBD transfected lysate(18.15 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Increased FAT10 expression is related to poor prognosis in pancreatic ductal adenocarcinoma.Sun GH, Liu YD, Yu G, Li N, Sun X, Yang J Tumour Biol. 2014 Feb 4. |