APG7L (Human) Recombinant Protein (Q01) View larger

APG7L (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APG7L (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about APG7L (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00010533-Q01
Product name: APG7L (Human) Recombinant Protein (Q01)
Product description: Human APG7L partial ORF ( NP_006386, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 10533
Gene name: ATG7
Gene alias: APG7-LIKE|APG7L|DKFZp434N0735|GSA7
Gene description: ATG7 autophagy related 7 homolog (S. cerevisiae)
Genbank accession: NM_006395
Immunogen sequence/protein sequence: MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Protein accession: NP_006386
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00010533-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Akt Suppresses Retrograde Degeneration of Dopaminergic Axons by Inhibition of Macroautophagy.Cheng HC, Kim SR, Oo TF, Kareva T, Yarygina O, Rzhetskaya M, Wang C, During M, Talloczy Z, Tanaka K, Komatsu M, Kobayashi K, Okano H, Kholodilov N, Burke RE.
J Neurosci. 2011 Feb 9;31(6):2125-35.

Reviews

Buy APG7L (Human) Recombinant Protein (Q01) now

Add to cart