| Brand: | Abnova |
| Reference: | H00010533-Q01 |
| Product name: | APG7L (Human) Recombinant Protein (Q01) |
| Product description: | Human APG7L partial ORF ( NP_006386, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 10533 |
| Gene name: | ATG7 |
| Gene alias: | APG7-LIKE|APG7L|DKFZp434N0735|GSA7 |
| Gene description: | ATG7 autophagy related 7 homolog (S. cerevisiae) |
| Genbank accession: | NM_006395 |
| Immunogen sequence/protein sequence: | MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD |
| Protein accession: | NP_006386 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Akt Suppresses Retrograde Degeneration of Dopaminergic Axons by Inhibition of Macroautophagy.Cheng HC, Kim SR, Oo TF, Kareva T, Yarygina O, Rzhetskaya M, Wang C, During M, Talloczy Z, Tanaka K, Komatsu M, Kobayashi K, Okano H, Kholodilov N, Burke RE. J Neurosci. 2011 Feb 9;31(6):2125-35. |