No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010527-M07 |
Product name: | IPO7 monoclonal antibody (M07), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IPO7. |
Clone: | 4G6 |
Isotype: | IgG2b Kappa |
Gene id: | 10527 |
Gene name: | IPO7 |
Gene alias: | FLJ14581|Imp7|MGC138673|RANBP7 |
Gene description: | importin 7 |
Genbank accession: | NM_006391 |
Immunogen: | IPO7 (NP_006382.1, 950 a.a. ~ 1038 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN |
Protein accession: | NP_006382.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | IPO7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of IPO7 expression in HeLa(Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Nuclear Extracellular Signal-Regulated Kinase 1 and 2 Translocation Is Mediated by Casein Kinase 2 and Accelerated by Autophosphorylation.Plotnikov A, Chuderland D, Karamansha Y, Livnah O, Seger R. Mol Cell Biol. 2011 Sep;31(17):3515-30. Epub 2011 Jul 5. |