No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010525-A02 |
Product name: | HYOU1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HYOU1. |
Gene id: | 10525 |
Gene name: | HYOU1 |
Gene alias: | DKFZp686N08236|FLJ94899|FLJ97572|Grp170|HSP12A|ORP150 |
Gene description: | hypoxia up-regulated 1 |
Genbank accession: | NM_006389 |
Immunogen: | HYOU1 (NP_006380, 901 a.a. ~ 999 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL |
Protein accession: | NP_006380 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | HYOU1, Regulated by LPLUNC1, Is Up-Regulated in Nasopharyngeal Carcinoma and Associated with Poor Prognosis.Zhou Y, Liao Q, Li X, Wang H, Wei F, Chen J, Yang J, Zeng Z, Guo X, Chen P, Zhang W, Tang K, Li X, Xiong W, Li G. J Cancer. 2016 Jan 12. 7(4):367-376. |