No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010522-M04 |
| Product name: | DEAF1 monoclonal antibody (M04), clone 1H8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DEAF1. |
| Clone: | 1H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10522 |
| Gene name: | DEAF1 |
| Gene alias: | NUDR|SPN|ZMYND5 |
| Gene description: | deformed epidermal autoregulatory factor 1 (Drosophila) |
| Genbank accession: | NM_021008 |
| Immunogen: | DEAF1 (NP_066288.2, 133 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG |
| Protein accession: | NP_066288.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | DEAF1 monoclonal antibody (M04), clone 1H8. Western Blot analysis of DEAF1 expression in human uterus myoma. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |