Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEMA4D monoclonal antibody (M01), clone 3B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about SEMA4D monoclonal antibody (M01), clone 3B4
| Brand: | Abnova |
| Reference: | H00010507-M01 |
| Product name: | SEMA4D monoclonal antibody (M01), clone 3B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA4D. |
| Clone: | 3B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10507 |
| Gene name: | SEMA4D |
| Gene alias: | C9orf164|CD100|FLJ33485|FLJ34282|FLJ39737|FLJ46484|M-sema-G|MGC169138|MGC169141|SEMAJ|coll-4 |
| Gene description: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
| Genbank accession: | BC054500 |
| Immunogen: | SEMA4D (AAH54500, 115 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSP |
| Protein accession: | AAH54500 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SEMA4D monoclonal antibody (M01), clone 3B4 Western Blot analysis of SEMA4D expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Phage Display Identification of CD100 in Human Atherosclerotic Plaque Macrophages and Foam Cells.Luque MC, Gutierrez PS, Debbas V, Martins WK, Puech-Leao P, Porto G, Coelho V, Boumsell L, Kalil J, Stolf B PLoS One. 2013 Sep 30;8(9):e75772. doi: 10.1371/journal.pone.0075772. |