No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010501-M01 |
Product name: | SEMA6B monoclonal antibody (M01), clone 2H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA6B. |
Clone: | 2H7 |
Isotype: | IgG2a Kappa |
Gene id: | 10501 |
Gene name: | SEMA6B |
Gene alias: | SEM-SEMA-Y|SEMA-VIB|SEMAN|semaZ |
Gene description: | sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B |
Genbank accession: | NM_020241 |
Immunogen: | SEMA6B (NP_064626, 28 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGEC |
Protein accession: | NP_064626 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SEMA6B monoclonal antibody (M01), clone 2H7. Western Blot analysis of SEMA6B expression in HepG2. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |