No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010494-M01 |
Product name: | STK25 monoclonal antibody (M01), clone 1G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STK25. |
Clone: | 1G6 |
Isotype: | IgG1 Kappa |
Gene id: | 10494 |
Gene name: | STK25 |
Gene alias: | DKFZp686J1430|SOK1|YSK1 |
Gene description: | serine/threonine kinase 25 (STE20 homolog, yeast) |
Genbank accession: | BC007852 |
Immunogen: | STK25 (AAH07852, 321 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR |
Protein accession: | AAH07852 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged STK25 is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.Zhang H, Ma X, Peng S, Nan X, Zhao H Int J Clin Exp Pathol. 2014 Oct 15;7(11):8105-11. eCollection 2014. |