No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010494-M01 |
| Product name: | STK25 monoclonal antibody (M01), clone 1G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK25. |
| Clone: | 1G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10494 |
| Gene name: | STK25 |
| Gene alias: | DKFZp686J1430|SOK1|YSK1 |
| Gene description: | serine/threonine kinase 25 (STE20 homolog, yeast) |
| Genbank accession: | BC007852 |
| Immunogen: | STK25 (AAH07852, 321 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR |
| Protein accession: | AAH07852 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged STK25 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.Zhang H, Ma X, Peng S, Nan X, Zhao H Int J Clin Exp Pathol. 2014 Oct 15;7(11):8105-11. eCollection 2014. |