VAT1 polyclonal antibody (A01) View larger

VAT1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VAT1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about VAT1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010493-A01
Product name: VAT1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant VAT1.
Gene id: 10493
Gene name: VAT1
Gene alias: FLJ20230|VATI
Gene description: vesicle amine transport protein 1 homolog (T. californica)
Genbank accession: NM_006373
Immunogen: VAT1 (NP_006364, 294 a.a. ~ 392 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKE
Protein accession: NP_006364
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010493-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010493-A01-1-6-1.jpg
Application image note: VAT1 polyclonal antibody (A01), Lot # 060608JCS1 Western Blot analysis of VAT1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VAT1 polyclonal antibody (A01) now

Add to cart