Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 471,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 471,00 €
Data sheet of LRRC41 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LRRC41 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010489-A01 |
| Product name: | LRRC41 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LRRC41. |
| Gene id: | 10489 |
| Gene name: | LRRC41 |
| Gene alias: | MGC126571|MGC126573|MUF1|PP7759|RP4-636H5.2 |
| Gene description: | leucine rich repeat containing 41 |
| Genbank accession: | NM_006369 |
| Immunogen: | LRRC41 (NP_006360, 86 a.a. ~ 195 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL |
| Protein accession: | NP_006360 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |