Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 393,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 393,07 €
Data sheet of CREB3 monoclonal antibody (M01), clone 3H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about CREB3 monoclonal antibody (M01), clone 3H5
| Brand: | Abnova |
| Reference: | H00010488-M01 |
| Product name: | CREB3 monoclonal antibody (M01), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CREB3. |
| Clone: | 3H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10488 |
| Gene name: | CREB3 |
| Gene alias: | LUMAN|LZIP|MGC15333|MGC19782 |
| Gene description: | cAMP responsive element binding protein 3 |
| Genbank accession: | NM_006368 |
| Immunogen: | CREB3 (NP_006359, 273 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG |
| Protein accession: | NP_006359 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CREB3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |