Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 768,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 768,00 €
Data sheet of CREB3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Re,WB-Tr,PLA-Ce |
More info about CREB3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00010488-D01P |
| Product name: | CREB3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CREB3 protein. |
| Gene id: | 10488 |
| Gene name: | CREB3 |
| Gene alias: | LUMAN|LZIP|MGC15333|MGC19782 |
| Gene description: | cAMP responsive element binding protein 3 |
| Genbank accession: | BC009402.2 |
| Immunogen: | CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG |
| Protein accession: | AAH09402.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CREB3 expression in transfected 293T cell line (H00010488-T02) by CREB3 MaxPab polyclonal antibody. Lane 1: CREB3 transfected lysate(41.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.Hacker B, Schultheis C, Doring M, Kurzik-Dumke U. Hum Mol Genet. 2018 Mar 14. [Epub ahead of print] |