Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Re,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00010488-D01P |
Product name: | CREB3 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CREB3 protein. |
Gene id: | 10488 |
Gene name: | CREB3 |
Gene alias: | LUMAN|LZIP|MGC15333|MGC19782 |
Gene description: | cAMP responsive element binding protein 3 |
Genbank accession: | BC009402.2 |
Immunogen: | CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG |
Protein accession: | AAH09402.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CREB3 expression in transfected 293T cell line (H00010488-T02) by CREB3 MaxPab polyclonal antibody. Lane 1: CREB3 transfected lysate(41.40 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Re,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.Hacker B, Schultheis C, Doring M, Kurzik-Dumke U. Hum Mol Genet. 2018 Mar 14. [Epub ahead of print] |