UBE2E3 MaxPab mouse polyclonal antibody (B01) View larger

UBE2E3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2E3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about UBE2E3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010477-B01
Product name: UBE2E3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human UBE2E3 protein.
Gene id: 10477
Gene name: UBE2E3
Gene alias: UBCH9|UbcM2
Gene description: ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
Genbank accession: NM_006357
Immunogen: UBE2E3 (NP_006348, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
Protein accession: NP_006348
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010477-B01-13-15-1.jpg
Application image note: Western Blot analysis of UBE2E3 expression in transfected 293T cell line (H00010477-T01) by UBE2E3 MaxPab polyclonal antibody.

Lane 1: UBE2E3 transfected lysate(22.77 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UBE2E3 MaxPab mouse polyclonal antibody (B01) now

Add to cart