TIMM44 purified MaxPab mouse polyclonal antibody (B01P) View larger

TIMM44 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM44 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about TIMM44 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00010469-B01P
Product name: TIMM44 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TIMM44 protein.
Gene id: 10469
Gene name: TIMM44
Gene alias: DKFZp686H05241|TIM44
Gene description: translocase of inner mitochondrial membrane 44 homolog (yeast)
Genbank accession: NM_006351.2
Immunogen: TIMM44 (NP_006342.2, 1 a.a. ~ 452 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQELAKNKEMKESIKKFRDEARRLEESDVLQEARRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL
Protein accession: NP_006342.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010469-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TIMM44 expression in transfected 293T cell line (H00010469-T01) by TIMM44 MaxPab polyclonal antibody.

Lane 1: TIMM44 transfected lysate(49.72 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TIMM44 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart