Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 833,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 833,00 €
Data sheet of FST polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about FST polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010468-A01 |
| Product name: | FST polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant FST. |
| Gene id: | 10468 |
| Gene name: | FST |
| Gene alias: | FS |
| Gene description: | follistatin |
| Genbank accession: | BC004107 |
| Immunogen: | FST (AAH04107, 1 a.a. ~ 344 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
| Protein accession: | AAH04107 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |