Brand: | Abnova |
Reference: | H00010465-A01 |
Product name: | PPIH polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant PPIH. |
Gene id: | 10465 |
Gene name: | PPIH |
Gene alias: | CYP-20|CYPH|MGC5016|SnuCyp-20|USA-CYP |
Gene description: | peptidylprolyl isomerase H (cyclophilin H) |
Genbank accession: | BC003412 |
Immunogen: | PPIH (AAH03412, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
Protein accession: | AAH03412 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.58 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |