Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PIBF1 monoclonal antibody (M02), clone 7B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about PIBF1 monoclonal antibody (M02), clone 7B7
| Brand: | Abnova |
| Reference: | H00010464-M02 |
| Product name: | PIBF1 monoclonal antibody (M02), clone 7B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIBF1. |
| Clone: | 7B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10464 |
| Gene name: | PIBF1 |
| Gene alias: | C13orf24|KIAA1008|PIBF|RP11-505F3.1 |
| Gene description: | progesterone immunomodulatory binding factor 1 |
| Genbank accession: | NM_006346 |
| Immunogen: | PIBF1 (NP_006337, 660 a.a. ~ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM |
| Protein accession: | NP_006337 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PIBF1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |