CLEC10A monoclonal antibody (M01), clone 2D6 View larger

CLEC10A monoclonal antibody (M01), clone 2D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC10A monoclonal antibody (M01), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CLEC10A monoclonal antibody (M01), clone 2D6

Brand: Abnova
Reference: H00010462-M01
Product name: CLEC10A monoclonal antibody (M01), clone 2D6
Product description: Mouse monoclonal antibody raised against a partial recombinant CLEC10A.
Clone: 2D6
Isotype: IgG2a Kappa
Gene id: 10462
Gene name: CLEC10A
Gene alias: CD301|CLECSF13|CLECSF14|HML|HML2
Gene description: C-type lectin domain family 10, member A
Genbank accession: NM_006344
Immunogen: CLEC10A (NP_006335.2, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCY
Protein accession: NP_006335.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010462-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010462-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CLEC10A is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLEC10A monoclonal antibody (M01), clone 2D6 now

Add to cart