Cart 16 Product Products 5 659,14 € (empty)
-
1 x ZNF385A-zi...121,50 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
5 659,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 16 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 659,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 659,14 €
Data sheet of MAD2L2 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MAD2L2 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00010459-B02P |
| Product name: | MAD2L2 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MAD2L2 protein. |
| Gene id: | 10459 |
| Gene name: | MAD2L2 |
| Gene alias: | MAD2B|REV7 |
| Gene description: | MAD2 mitotic arrest deficient-like 2 (yeast) |
| Genbank accession: | BC015244 |
| Immunogen: | MAD2L2 (AAH15244.1, 1 a.a. ~ 211 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS |
| Protein accession: | AAH15244.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MAD2L2 expression in transfected 293T cell line (H00010459-T02) by MAD2L2 MaxPab polyclonal antibody. Lane 1: MAD2L2 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |