MAD2L2 MaxPab mouse polyclonal antibody (B02) View larger

MAD2L2 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAD2L2 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MAD2L2 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00010459-B02
Product name: MAD2L2 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human MAD2L2 protein.
Gene id: 10459
Gene name: MAD2L2
Gene alias: MAD2B|REV7
Gene description: MAD2 mitotic arrest deficient-like 2 (yeast)
Genbank accession: BC015244
Immunogen: MAD2L2 (AAH15244, 1 a.a. ~ 211 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Protein accession: AAH15244
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010459-B02-13-15-1.jpg
Application image note: Western Blot analysis of MAD2L2 expression in transfected 293T cell line (H00010459-T02) by MAD2L2 MaxPab polyclonal antibody.

Lane 1: MAD2L2 transfected lysate(23.21 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAD2L2 MaxPab mouse polyclonal antibody (B02) now

Add to cart