PPIE polyclonal antibody (A01) View larger

PPIE polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPIE polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PPIE polyclonal antibody (A01)

Brand: Abnova
Reference: H00010450-A01
Product name: PPIE polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PPIE.
Gene id: 10450
Gene name: PPIE
Gene alias: CYP-33|MGC111222|MGC3736
Gene description: peptidylprolyl isomerase E (cyclophilin E)
Genbank accession: NM_006112
Immunogen: PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Protein accession: NP_006103
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010450-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00010450-A01-1-25-1.jpg
Application image note: PPIE polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of PPIE expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPIE polyclonal antibody (A01) now

Add to cart