Brand: | Abnova |
Reference: | H00010450-A01 |
Product name: | PPIE polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PPIE. |
Gene id: | 10450 |
Gene name: | PPIE |
Gene alias: | CYP-33|MGC111222|MGC3736 |
Gene description: | peptidylprolyl isomerase E (cyclophilin E) |
Genbank accession: | NM_006112 |
Immunogen: | PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD |
Protein accession: | NP_006103 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | PPIE polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of PPIE expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |