No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010449-M05 |
Product name: | ACAA2 monoclonal antibody (M05), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACAA2. |
Clone: | 2F7 |
Isotype: | IgG1 Kappa |
Gene id: | 10449 |
Gene name: | ACAA2 |
Gene alias: | DSAEC|FLJ35992|FLJ95265 |
Gene description: | acetyl-Coenzyme A acyltransferase 2 |
Genbank accession: | NM_006111 |
Immunogen: | ACAA2 (NP_006102, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV |
Protein accession: | NP_006102 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | ACAA2 monoclonal antibody (M05), clone 2F7. Western Blot analysis of ACAA2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |