No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010438-M10 |
Product name: | C1D monoclonal antibody (M10), clone 4H5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant C1D. |
Clone: | 4H5 |
Isotype: | IgG2a Kappa |
Gene id: | 10438 |
Gene name: | C1D |
Gene alias: | MGC12261|MGC14659|SUNCOR |
Gene description: | nuclear DNA-binding protein |
Genbank accession: | BC016284 |
Immunogen: | C1D (AAH16284, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS |
Protein accession: | AAH16284 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (41.25 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of C1D expression in transfected 293T cell line by C1D monoclonal antibody (M10), clone 4H5. Lane 1: C1D transfected lysate(16 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |