C1D monoclonal antibody (M03), clone 6H2 View larger

C1D monoclonal antibody (M03), clone 6H2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1D monoclonal antibody (M03), clone 6H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about C1D monoclonal antibody (M03), clone 6H2

Brand: Abnova
Reference: H00010438-M03
Product name: C1D monoclonal antibody (M03), clone 6H2
Product description: Mouse monoclonal antibody raised against a full length recombinant C1D.
Clone: 6H2
Isotype: IgG2a Kappa
Gene id: 10438
Gene name: C1D
Gene alias: MGC12261|MGC14659|SUNCOR
Gene description: nuclear DNA-binding protein
Genbank accession: BC005235
Immunogen: C1D (AAH05235, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
Protein accession: AAH05235
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010438-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.25 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010438-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to C1D on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1D monoclonal antibody (M03), clone 6H2 now

Add to cart