Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDC42EP2 monoclonal antibody (M01), clone 2H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CDC42EP2 monoclonal antibody (M01), clone 2H7
| Brand: | Abnova |
| Reference: | H00010435-M01 |
| Product name: | CDC42EP2 monoclonal antibody (M01), clone 2H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC42EP2. |
| Clone: | 2H7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10435 |
| Gene name: | CDC42EP2 |
| Gene alias: | BORG1|CEP2 |
| Gene description: | CDC42 effector protein (Rho GTPase binding) 2 |
| Genbank accession: | NM_006779 |
| Immunogen: | CDC42EP2 (NP_006770, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT |
| Protein accession: | NP_006770 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 monoclonal antibody (M01), clone 2H7. Lane 1: CDC42EP2 transfected lysate(22.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with CDC42 effector proteins.Schnack C, Danzer KM, Hengerer B, Gillardon F. Neuroscience. 2008 Jul 17;154(4):1450-7. Epub 2008 Feb 29. |